| Article ID | Journal | Published Year | Pages | File Type |
|---|---|---|---|---|
| 4240360 | Journal of Vascular and Interventional Radiology | 2010 | 15 Pages |
Abstract
Angiogenesis is a complex process critical for embryonic development and for survival. It is also a critical player in many pathologic processes, most notably in neoplasia. The cell signaling pathways involved in angiogenesis have become key targets for drug design, with more than 2,500 clinical trials currently under way. This review summarizes the essential features of angiogenesis and discusses therapeutic strategies that have been applied to specific diseases known to be associated with perturbation of normal angiogenic control.
Keywords
MMPFDARTKVEGFRPHDPGFVHLPDGFHIFTGFS1PERKmRNAPI3KmTORbFGFdll4MAPKmessenger RNAVon Hippel–LindauSphingosine-1-phosphatetransforming growth factorTyrosine kinaseRTK, Receptor tyrosine kinaseFood and Drug Administrationplacenta growth factorHypoxia-inducible factorVascular endothelial growth factorVascular Endothelial Growth Factor (VEGF)platelet-derived growth factorbasic fibroblast growth factorPhosphatidylinositol 3-kinasematrix metalloproteinasemammalian target of rapamycinmitogen-activated protein kinaseProlyl hydroxylaseExtracellular signal–regulated kinasevascular endothelial growth factor receptor
Related Topics
Health Sciences
Medicine and Dentistry
Radiology and Imaging
Authors
Rahmi PhD, MD, Thomas G. MD, Stephan MD, Robin PhD,