Article ID | Journal | Published Year | Pages | File Type |
---|---|---|---|---|
6109611 | Journal of Hepatology | 2009 | 13 Pages |
Abstract
These novel findings are important because they point to another risk factor of smoking, i.e., that of contributing to NAFLD. In addition, our results showing that both AMPK and SREBP are critically involved in these effects of smoke point to the potential use of these molecules as targets for treatment of cigarette smoke-induced metabolic diseases.
Keywords
ACC5-aminoimidazole-4-carboxamide ribonucleosideSREBPsapoBADRPLDLRHMGCRSSWGAPDHFASMSWAICARAMPK3-Hydroxy-3-methylglutaryl CoA reductaseAMP-activated protein kinaseMTTApolipoprotein Bacetyl-CoA carboxylasefatty acid synthaseadipose differentiation-related proteinglyceraldehyde-3-phosphate dehydrogenase
Related Topics
Health Sciences
Medicine and Dentistry
Gastroenterology
Authors
Hongwei Yuan, John Y.-J. Shyy, Manuela Martins-Green,