| Article ID | Journal | Published Year | Pages | File Type | 
|---|---|---|---|---|
| 10797233 | Biochimica et Biophysica Acta (BBA) - Biomembranes | 2013 | 13 Pages | 
Abstract
												⺠We present the structure of the N-terminal portion of the human apelin receptor (AR). ⺠Combining NMR data and MD simulation, we place this in the full-length AR context. ⺠The first transmembrane helix of AR is a kinked helix and is required for trafficking. ⺠The AR N-terminal tail has an anionic surface ideal for binding its ligand, apelin. ⺠This is one of the first structural characterizations of a peptide-activated GPCR.
											Keywords
												CSINOESYHEKNOEPDBRMSDTOCSYDTTIPTGDSSDPPCERKTFAHSQCDPCFBSDMEMGPCRPEInuclear magnetic resonanceBSADulbecco's modified Eagle MediumG-protein coupled receptorbovine serum albuminTrifluoracetic acidisopropyl β-D-1-thiogalactopyranosideNMRDivide and conquernuclear Overhauser enhancementDodecylphosphocholineMolecular dynamicsdipalmitoylphosphatidylcholineMembrane protein structuresodium 2,2-dimethyl-2-silapentane-5-sulfonatefetal bovine serumchemical shift indexMolecular dynamics simulationsNOE spectroscopyTotal correlation spectroscopytransmembraneLuria brothHomology modelroot mean square deviationhemagglutininpolymerase chain reactionPCRProtein Data BankPolyethyleniminehuman embryonic kidneyextracellular signal-regulated kinaseapelin receptorheteronuclear single quantum coherence
												Related Topics
												
													Life Sciences
													Biochemistry, Genetics and Molecular Biology
													Biochemistry
												
											Authors
												David N. Langelaan, Tyler Reddy, Aaron W. Banks, Graham Dellaire, Denis J. Dupré, Jan K. Rainey, 
											