Article ID | Journal | Published Year | Pages | File Type |
---|---|---|---|---|
10802755 | Biochimica et Biophysica Acta (BBA) - Molecular Cell Research | 2011 | 13 Pages |
Abstract
⺠This review summarizes mechanisms that lead to the targeting of ER proteins to individual membrane domains (e.g., rough ER). ⺠Formation of interactions between the Sec61 proteins, ribosomes and mRNAs is critical for rough ER targeting. ⺠The equilibrium between atlastins, reticulons and DP1/Yop1p determines the formation of smooth ER tubules. ⺠Targeting to the MAM depends on ER redox and on cytosolic or mitochondrial sorting motifs. ⺠Targeting to ERES, ERQC, and sites of peroxisome and lipid droplet biogenesis depend on COPI and COPII proteins.
Keywords
KDELGRPEREsIP3RSTIM1SREBPTIP47LRP6ERMESRFPCOPRussell bodiesVAPBEndoplasmic reticulum exit sitesAmfrBAP31Lys-Asp-Glu-Leulow-density lipoprotein receptor-related protein 6ERQCTRAPPDIERADGFPNADPHPAMERKMAMSRPSNAREXBP1BiPOstEndoplasmic reticulum associated degradationTRAMCHOPDiacylglycerol acyltransferasesignal recognition particleEndoplasmic reticulum (ER)sarco/endoplasmic reticulum Ca2+-ATPaseendoplasmic reticulummitochondria-associated membranelipid dropletSERCAStromal interaction molecule 1X-box binding protein 1Immunoglobulin binding proteinglucose regulated proteinprotein disulfide isomerasegreen fluorescent proteinred fluorescent proteinPERKcoat protein complexreduced nicotinamide adenine dinucleotide phosphateextracellular signal-regulated kinaseInositol 1,4,5-trisphosphate receptorAutocrine motility factor receptor
Related Topics
Life Sciences
Biochemistry, Genetics and Molecular Biology
Biochemistry
Authors
Emily M. Lynes, Thomas Simmen,