Article ID | Journal | Published Year | Pages | File Type |
---|---|---|---|---|
5590708 | Infection, Genetics and Evolution | 2016 | 10 Pages |
Abstract
Human Immunodeficiency Virus type 1 (HIV-1) is characterised by vast genetic diversity. Globally circulating HIV-1 viruses are classified into distinct phylogenetic strains (subtypes, sub-subtypes) and several recombinant forms. Here we describe the characteristics and evolution of European HIV-1 epidemic over time through a review of published literature and updated queries of existing HIV-1 sequence databases. HIV-1 in Western and Central Europe was introduced in the early-1980s in the form of subtype B, which is still the predominant clade. However, in Eastern Europe (Former Soviet Union (FSU) countries and Russia) the predominant strain, introduced into Ukraine in the mid-1990s, is subtype A (AFSU) with transmission mostly occurring in People Who Inject Drugs (PWID). In recent years, the epidemic is evolving towards a complex tapestry with an increase in the prevalence of non-B subtypes and recombinants in Western and Central Europe. Non-B epidemics are mainly associated with immigrants, heterosexuals and females but more recently, non-B clades have also spread amongst groups where non-B strains were previously absent - non-immigrant European populations and amongst men having sex with men (MSM). In some countries, non-B clades have spread amongst the native population, for example subtype G in Portugal and subtype A in Greece, Albania and Cyprus. Romania provides a unique case where sub-subtype F1 has predominated throughout the epidemic. In contrast, HIV-1 epidemic in FSU countries remains more homogeneous with AFSU clade predominating in all countries. The differences between the evolution of the Western epidemic and the Eastern epidemic may be attributable to differences in transmission risk behaviours, lifestyle and the patterns of human mobility. The study of HIV-1 epidemic diversity provides a useful tool by which we can understand the history of the pandemic in addition to allowing us to monitor the spread and growth of the epidemic over time.
Keywords
EEAunique recombinant formURFDRCMSWTMRCAPWIDECDCMSMSIVCRFEuropean Unionpeople who inject drugsSpreadMolecular epidemiologyAIDSReverse transcriptaseGenetic diversityDemocratic Republic of CongoSubtypesWorld Health Organizationacquired immunodeficiency syndromecirculating recombinant formPhylogenyMen who have sex with menEuropean Centre for Disease Prevention and ControlEuropean economic areaHIV-1human immunodeficiency virusHIVProteaseWHO
Related Topics
Life Sciences
Agricultural and Biological Sciences
Ecology, Evolution, Behavior and Systematics
Authors
Apostolos Beloukas, Alexandros Psarris, Polina Giannelou, Evangelia Kostaki, Angelos Hatzakis, Dimitrios Paraskevis,