کد مقاله | کد نشریه | سال انتشار | مقاله انگلیسی | نسخه تمام متن |
---|---|---|---|---|
6109611 | 1211209 | 2009 | 13 صفحه PDF | دانلود رایگان |
عنوان انگلیسی مقاله ISI
Second-hand smoke stimulates lipid accumulation in the liver by modulating AMPK and SREBP-1
دانلود مقاله + سفارش ترجمه
دانلود مقاله ISI انگلیسی
رایگان برای ایرانیان
کلمات کلیدی
ACC5-aminoimidazole-4-carboxamide ribonucleosideSREBPsapoBADRPLDLRHMGCRSSWGAPDHFASMSWAICARAMPK3-Hydroxy-3-methylglutaryl CoA reductase - 3-Hydroxy-3-methylglutaryl CoA ردوکتازAMP-activated protein kinase - AMP-پروتئین کیناز فعال شده استMTT - MTTApolipoprotein B - آپولیپوپروتئین Bacetyl-CoA carboxylase - استیل کروکسی سیلازfatty acid synthase - اسید چرب سنتازadipose differentiation-related protein - پروتئین مرتبط با تمایز چربیglyceraldehyde-3-phosphate dehydrogenase - گلیسرالیدید-3-فسفات دهیدروژناز
موضوعات مرتبط
علوم پزشکی و سلامت
پزشکی و دندانپزشکی
بیماریهای گوارشی
پیش نمایش صفحه اول مقاله
![عکس صفحه اول مقاله: Second-hand smoke stimulates lipid accumulation in the liver by modulating AMPK and SREBP-1 Second-hand smoke stimulates lipid accumulation in the liver by modulating AMPK and SREBP-1](/preview/png/6109611.png)
چکیده انگلیسی
These novel findings are important because they point to another risk factor of smoking, i.e., that of contributing to NAFLD. In addition, our results showing that both AMPK and SREBP are critically involved in these effects of smoke point to the potential use of these molecules as targets for treatment of cigarette smoke-induced metabolic diseases.
ناشر
Database: Elsevier - ScienceDirect (ساینس دایرکت)
Journal: Journal of Hepatology - Volume 51, Issue 3, September 2009, Pages 535-547
Journal: Journal of Hepatology - Volume 51, Issue 3, September 2009, Pages 535-547
نویسندگان
Hongwei Yuan, John Y.-J. Shyy, Manuela Martins-Green,