کد مقاله کد نشریه سال انتشار مقاله انگلیسی نسخه تمام متن
2016338 1067652 2011 6 صفحه PDF دانلود رایگان
عنوان انگلیسی مقاله ISI
Osmotin purified from the latex of Calotropis procera: Biochemical characterization, biological activity and role in plant defense
موضوعات مرتبط
علوم زیستی و بیوفناوری علوم کشاورزی و بیولوژیک دانش گیاه شناسی
پیش نمایش صفحه اول مقاله
Osmotin purified from the latex of Calotropis procera: Biochemical characterization, biological activity and role in plant defense
چکیده انگلیسی

A protein, similar to osmotin- and thaumatin-like proteins, was purified from Calotropis procera (Ait.) R.Br latex. The isolation procedure required two cation exchange chromatography steps on 50 mM Na-acetate buffer (pH 5.0) CM-Sepharose Fast Flow and 25 mM Na-phosphate buffer (pH 6.0) Resource-S, respectively. The protein purity was confirmed by an unique N-terminal sequence [ATFTIRNNCPYTIWAAAVPGGGRRLNSGGTWTINVAPGTA]. The osmotin (CpOsm) appeared as a single band (20,100 Da) in sodium dodecyl sulfate-polyacrylamide gel electrophoresis and as two spots in two-dimensional electrophoresis (pI 8.9 and 9.1). Both polypeptides were further identified by mass spectrometry as two osmotin isoforms with molecular masses of 22,340 and 22,536 Da. The CpOsm exerted antifungal activity against Fusarium solani (IC50 = 67.0 μg mL−1), Neurospora sp. (IC50 = 57.5 μg mL−1) and Colletotrichum gloeosporioides (IC50 = 32.1 μg mL−1). However, this activity was lost when the protein was previously treated with a reducing agent (DTT, Dithiothreitol) suggesting the presence of disulfide bounds stabilizing the protein. The occurrence of osmotin in latex substantiates the defensive role of these fluids.

Figure optionsDownload as PowerPoint slideHighlights
► Two osmotins were purified and characterized from Calotropis procera latex.
► These proteins inhibited growth and spore germination of three phytopathogen fungi.
► The occurrence of osmotin in latex substantiates the defensive role of these fluids.

ناشر
Database: Elsevier - ScienceDirect (ساینس دایرکت)
Journal: Plant Physiology and Biochemistry - Volume 49, Issue 7, July 2011, Pages 738–743
نویسندگان
, , , , , ,