| کد مقاله | کد نشریه | سال انتشار | مقاله انگلیسی | نسخه تمام متن |
|---|---|---|---|---|
| 10461571 | 924518 | 2012 | 16 صفحه PDF | دانلود رایگان |
عنوان انگلیسی مقاله ISI
Where and what is the paralaminar nucleus? A review on a unique and frequently overlooked area of the primate amygdala
دانلود مقاله + سفارش ترجمه
دانلود مقاله ISI انگلیسی
رایگان برای ایرانیان
کلمات کلیدی
PSA-NCAMGADSSTVIPNPYCENCRFDATCOA5-HTDcx5-HTTAStrpCREBBDZAAAIntercalated islandsAbpCABmcamygdalostriatal areaphosphorylated cyclic AMP response element binding proteinDHTAHACOPABSCTABMCCEMPACDBHBDNF - BDNF یا فاکتور نورونزایی مشتقشده از مغز Bpc - BPCglutamic acid decarboxylase - glutamic acid dearboxylasePACs - PAC هاAChE - آهیStress - استرس یا فشار روانیAcetylcholinesterase - استیل کولین استرازAnxiety - اضطرابDepression - افسردگیDopamine transporter - انتقال دهنده دوپامینganglionic eminence - برجسته گانگلیونیBrdU - بروموداکسی اوریدینlateral ventricle - بطن جانبیtyrosine hydroxylase - تیروزین هیدروکسیلازDopamine - دوپامینdopamine beta hydroxylase - دوپامین بتا هیدروکسیلازdoublecortin - دوچرخهSerotonin - سروتونینserotonin transporter - سروتونین حمل کنندهSomatostatin - سوماتواستاتینcorticotropin releasing factor - عامل آزاد کننده کورتیکوتروپینBrain-derived neurotrophic factor - فاکتور نوروتروفی مشتق شده از مغزZinc - فلز رویamygdalohippocampal area - منطقه amygdalohippocampalanterior amygdaloid area - ناحیه قدام ناحیه کمریnorepinephrine - نوراپی نفرینneurotensin - نوروتنسینNeurogenesis - نوروژنزlateral nucleus - هسته جانبیposterior cortical nucleus - هسته قشر خلفیanterior cortical nucleus - هسته قشر قدامیmedial nucleus - هسته محوریcentral nucleus - هسته مرکزیbasolateral nucleus - هسته نزولیBasal nucleus - هسته پایهHippocampus - هیپوکامپ Parvalbumin - پاروالبومینPlasticity - پلاستیکvasoactive intestinal peptide - پپتید روده روده ایCalretinin - کالورتینینcalbindin - کلبیندینexternal capsule - کپسول خارجیBenzodiazepine receptor - گیرنده بنزودیازپینglucocorticoid receptor - گیرنده گلوکوکورتیکوئیدNeuropeptide Y - یوروپروتئین Y
موضوعات مرتبط
علوم زیستی و بیوفناوری
علم عصب شناسی
علوم اعصاب رفتاری
پیش نمایش صفحه اول مقاله
چکیده انگلیسی
⺠Paralaminar nucleus is a subnucleus of the amygdala. ⺠Paralaminar nucleus is particularly prominent in human and non-human primates. ⺠High densities of receptors and proteins linked to mood disorders are present in this structure. ⺠Immature-appearing cells in the paralaminar nucleus may be important in plasticity mediated processes.
ناشر
Database: Elsevier - ScienceDirect (ساینس دایرکت)
Journal: Neuroscience & Biobehavioral Reviews - Volume 36, Issue 1, January 2012, Pages 520-535
Journal: Neuroscience & Biobehavioral Reviews - Volume 36, Issue 1, January 2012, Pages 520-535
نویسندگان
Danielle M. deCampo, Julie L. Fudge,