کد مقاله | کد نشریه | سال انتشار | مقاله انگلیسی | نسخه تمام متن |
---|---|---|---|---|
5590708 | 1570157 | 2016 | 10 صفحه PDF | دانلود رایگان |
عنوان انگلیسی مقاله ISI
Molecular epidemiology of HIV-1 infection in Europe: An overview
دانلود مقاله + سفارش ترجمه
دانلود مقاله ISI انگلیسی
رایگان برای ایرانیان
کلمات کلیدی
EEAunique recombinant formURFDRCMSWTMRCAPWIDECDCMSMSIVCRFEuropean Union - اتحادیه اروپاpeople who inject drugs - افرادی که مواد مخدر مصرف می کنندSpread - انتشار دادنMolecular epidemiology - اپیدمیولوژی مولکولیAIDS - ایدزReverse transcriptase - ترانس کریپتاز معکوس یا وارونویسGenetic diversity - تنوع ژنتیکیDemocratic Republic of Congo - جمهوری دموکراتیک کنگوSubtypes - زیرمجموعه هاWorld Health Organization - سازمان بهداشت جهانیacquired immunodeficiency syndrome - سندرم نقص ایمنی به دست آوردcirculating recombinant form - فرم تجدید پذیرPhylogeny - فیلوژنیMen who have sex with men - مردانی که با مردان رابطه جنسی دارندEuropean Centre for Disease Prevention and Control - مرکز اروپا برای پیشگیری و کنترل بیماریEuropean economic area - منطقه اقتصادی اروپاHIV-1 - ویروس اچ آی وی نوع یکhuman immunodeficiency virus - ویروس نقص ایمنی انسانیHIV - ویروس نقص ایمنی انسانی Protease - پروتئازWHO - که
موضوعات مرتبط
علوم زیستی و بیوفناوری
علوم کشاورزی و بیولوژیک
بوم شناسی، تکامل، رفتار و سامانه شناسی
پیش نمایش صفحه اول مقاله

چکیده انگلیسی
Human Immunodeficiency Virus type 1 (HIV-1) is characterised by vast genetic diversity. Globally circulating HIV-1 viruses are classified into distinct phylogenetic strains (subtypes, sub-subtypes) and several recombinant forms. Here we describe the characteristics and evolution of European HIV-1 epidemic over time through a review of published literature and updated queries of existing HIV-1 sequence databases. HIV-1 in Western and Central Europe was introduced in the early-1980s in the form of subtype B, which is still the predominant clade. However, in Eastern Europe (Former Soviet Union (FSU) countries and Russia) the predominant strain, introduced into Ukraine in the mid-1990s, is subtype A (AFSU) with transmission mostly occurring in People Who Inject Drugs (PWID). In recent years, the epidemic is evolving towards a complex tapestry with an increase in the prevalence of non-B subtypes and recombinants in Western and Central Europe. Non-B epidemics are mainly associated with immigrants, heterosexuals and females but more recently, non-B clades have also spread amongst groups where non-B strains were previously absent - non-immigrant European populations and amongst men having sex with men (MSM). In some countries, non-B clades have spread amongst the native population, for example subtype G in Portugal and subtype A in Greece, Albania and Cyprus. Romania provides a unique case where sub-subtype F1 has predominated throughout the epidemic. In contrast, HIV-1 epidemic in FSU countries remains more homogeneous with AFSU clade predominating in all countries. The differences between the evolution of the Western epidemic and the Eastern epidemic may be attributable to differences in transmission risk behaviours, lifestyle and the patterns of human mobility. The study of HIV-1 epidemic diversity provides a useful tool by which we can understand the history of the pandemic in addition to allowing us to monitor the spread and growth of the epidemic over time.
ناشر
Database: Elsevier - ScienceDirect (ساینس دایرکت)
Journal: Infection, Genetics and Evolution - Volume 46, December 2016, Pages 180-189
Journal: Infection, Genetics and Evolution - Volume 46, December 2016, Pages 180-189
نویسندگان
Apostolos Beloukas, Alexandros Psarris, Polina Giannelou, Evangelia Kostaki, Angelos Hatzakis, Dimitrios Paraskevis,