| کد مقاله | کد نشریه | سال انتشار | مقاله انگلیسی | نسخه تمام متن | 
|---|---|---|---|---|
| 10797233 | 1053209 | 2013 | 13 صفحه PDF | دانلود رایگان | 
عنوان انگلیسی مقاله ISI
												Structural features of the apelin receptor N-terminal tail and first transmembrane segment implicated in ligand binding and receptor trafficking
												
											دانلود مقاله + سفارش ترجمه
													دانلود مقاله ISI انگلیسی
رایگان برای ایرانیان
																																												کلمات کلیدی
												CSINOESYHEKNOEPDBRMSDTOCSYDTTIPTGDSSDPPCERKTFAHSQCDPCFBSDMEMGPCRPEInuclear magnetic resonance -  رزونانس مغناطیسی هستهایBSA - BSADulbecco's modified Eagle Medium - Eagle Medium اصلاح شده DulbeccoG-protein coupled receptor - G-پروتئین همراه گیرندهbovine serum albumin - آلبومین سرم گاوTrifluoracetic acid - اسید Trifluoraceticisopropyl β-D-1-thiogalactopyranoside - ایزوپروپیل β-D-1-thiogalactopyranosideNMR - تشدید مغناطیسی هستهای Divide and conquer - تفرقه بینداز و حکومت کنnuclear Overhauser enhancement - تقویت Overhauser هسته ایDodecylphosphocholine - دودهیل فسفو هولینMolecular dynamics - دینامیک ملکولی یا پویایی مولکولیdipalmitoylphosphatidylcholine - دیپالمیتویف فسفاتیدیل کولینMembrane protein structure - ساختار پروتئین غشاءsodium 2,2-dimethyl-2-silapentane-5-sulfonate - سدیم 2،2-دی متیل-2-سیلپنتان 5-سولفوناتfetal bovine serum - سرم جنین گاوchemical shift index - شاخص تغییر شیمیائیMolecular dynamics simulations - شبیه سازی پویایی مولکولیNOE spectroscopy - طیف سنجی NOETotal correlation spectroscopy - طیف سنجی مجموع همبستگیtransmembrane - فرابنفشLuria broth - لوریا بوثهHomology model - مدل همولوگاییroot mean square deviation - میانگین انحراف مربع ریشهhemagglutinin - هماگلوتینینpolymerase chain reaction - واکنش زنجیره ای پلیمرازPCR - واکنش زنجیرهٔ پلیمرازProtein Data Bank - پروتئین بانک اطلاعاتیPolyethylenimine - پلی اتیلنhuman embryonic kidney - کلیه جنین انسانextracellular signal-regulated kinase - کیناز تنظیم شده سیگنال خارج سلولیapelin receptor - گیرنده آپلینheteronuclear single quantum coherence - یکپارچگی کوانتومی تک هسته ای
												موضوعات مرتبط
												
													علوم زیستی و بیوفناوری
													بیوشیمی، ژنتیک و زیست شناسی مولکولی
													 زیست شیمی
												
											پیش نمایش صفحه اول مقاله
												 
												چکیده انگلیسی
												⺠We present the structure of the N-terminal portion of the human apelin receptor (AR). ⺠Combining NMR data and MD simulation, we place this in the full-length AR context. ⺠The first transmembrane helix of AR is a kinked helix and is required for trafficking. ⺠The AR N-terminal tail has an anionic surface ideal for binding its ligand, apelin. ⺠This is one of the first structural characterizations of a peptide-activated GPCR.
											ناشر
												Database: Elsevier - ScienceDirect (ساینس دایرکت)
Journal: Biochimica et Biophysica Acta (BBA) - Biomembranes - Volume 1828, Issue 6, June 2013, Pages 1471-1483
											Journal: Biochimica et Biophysica Acta (BBA) - Biomembranes - Volume 1828, Issue 6, June 2013, Pages 1471-1483
نویسندگان
												David N. Langelaan, Tyler Reddy, Aaron W. Banks, Graham Dellaire, Denis J. Dupré, Jan K. Rainey,