| کد مقاله | کد نشریه | سال انتشار | مقاله انگلیسی | نسخه تمام متن |
|---|---|---|---|---|
| 4240360 | 1283061 | 2010 | 15 صفحه PDF | دانلود رایگان |
عنوان انگلیسی مقاله ISI
Angiogenesis and Current Antiangiogenic Strategies for the Treatment of Cancer
دانلود مقاله + سفارش ترجمه
دانلود مقاله ISI انگلیسی
رایگان برای ایرانیان
کلمات کلیدی
MMPFDARTKVEGFRPHDPGFVHLPDGFHIFTGFS1PERKmRNAPI3KmTORbFGFdll4 - DLL4MAPK - MAPKmessenger RNA - RNA messengerVon Hippel–Lindau - از Hippel-LindauSphingosine-1-phosphate - اسپینگسین-1-فسفاتtransforming growth factor - تبدیل فاکتور رشدTyrosine kinase - تیروزین کینازRTK, Receptor tyrosine kinase - تیروزین کینازهای گیرنده ایFood and Drug Administration - سازمان غذا و داروplacenta growth factor - عامل رشد جفتHypoxia-inducible factor - فاکتور القاء کننده هیپوکسیVascular endothelial growth factor - فاکتور رشد اندوتلیال عروقیVascular Endothelial Growth Factor (VEGF) - فاکتور رشد اندوتلیال عروقی (VEGF)platelet-derived growth factor - فاکتور رشد حاصل از پلاکتbasic fibroblast growth factor - فاکتور رشد فیبروبلاست پایهPhosphatidylinositol 3-kinase - فسفاتیدیلینواستیل 3-کینازmatrix metalloproteinase - ماتریکس متالوپروتئینازmammalian target of rapamycin - هدف پستانداران رپامایسینmitogen-activated protein kinase - پروتئین کیناز فعال با mitogenProlyl hydroxylase - پرولیل هیدروکسیلازExtracellular signal–regulated kinase - کیناز تنظیم شده با سیگنال غیر سلولیvascular endothelial growth factor receptor - گیرنده فاکتور رشد اندوتلیال عروقی
موضوعات مرتبط
علوم پزشکی و سلامت
پزشکی و دندانپزشکی
رادیولوژی و تصویربرداری
پیش نمایش صفحه اول مقاله
چکیده انگلیسی
Angiogenesis is a complex process critical for embryonic development and for survival. It is also a critical player in many pathologic processes, most notably in neoplasia. The cell signaling pathways involved in angiogenesis have become key targets for drug design, with more than 2,500 clinical trials currently under way. This review summarizes the essential features of angiogenesis and discusses therapeutic strategies that have been applied to specific diseases known to be associated with perturbation of normal angiogenic control.
ناشر
Database: Elsevier - ScienceDirect (ساینس دایرکت)
Journal: Journal of Vascular and Interventional Radiology - Volume 21, Issue 12, December 2010, Pages 1791-1805
Journal: Journal of Vascular and Interventional Radiology - Volume 21, Issue 12, December 2010, Pages 1791-1805
نویسندگان
Rahmi PhD, MD, Thomas G. MD, Stephan MD, Robin PhD,