کد مقاله | کد نشریه | سال انتشار | مقاله انگلیسی | نسخه تمام متن |
---|---|---|---|---|
8340623 | 1541247 | 2015 | 12 صفحه PDF | دانلود رایگان |
عنوان انگلیسی مقاله ISI
Study of PTEN subcellular localization
دانلود مقاله + سفارش ترجمه
دانلود مقاله ISI انگلیسی
رایگان برای ایرانیان
کلمات کلیدی
GFPIPCIP3RCLSYFPPMLPAMNLSFRAPVDACSTSPIP3Ndfip1AKAPNedd4COXnESPIP2RFPOMMHauspCa2+ - Ca2 +I/R - I / RMAMs - MAM هاischemic preconditioning - preconditioning ایسکمیکROS - ROSstaurosporine - استوسوسورپینArachidonic acid - اسید آراشیدونیکischemia–reperfusion - ایسکمی-رپرفیوژنImmunofluorescence - ایمونوفلورسانسApoptosis - خزان یاختهایARA - در حال حاضرCancer - سرطانcytochrome c oxidase - سیتوکروم سی اکسیدازnuclear export signal - سیگنال صادرات هسته ایnuclear localization signal - سیگنال محلی سازی هسته ایendoplasmic reticulum - شبکه آندوپلاسمی Co-IP - شرکت-IPMitochondria-associated membranes - غشاهای مرتبط با میتوکندریاouter mitochondrial membrane - غشای بیرونی میتوکندریPlasma membrane - غشای پلاسماphosphatase and tensin homolog deleted on chromosome 10 - فسفاتاز و هومولوگ تنسین حذف شده در کروموزوم 10phosphatidylinositol-4,5-bisphosphate - فسفاتیدیلینستول-4،5-بیسفسفاتphosphatidylinositol-3,4,5-trisphosphate - فسفاتیدیلینواستیل 3،4،5-تری فسفاتfluorescence recovery after photobleaching - فلوئورسانس پس از فوتوبلاسیکPromyelocytic leukemia - لوسمی PromyelocyticCell death - مرگ سلولی Mitochondria - میتوکندریاCo-Immunoprecipitation - هم ایمن زداییA kinase anchoring protein - پروتئین ankoring kinaseyellow fluorescent protein - پروتئین فلورسنت زردgreen fluorescent protein - پروتئین فلورسنت سبزred fluorescent protein - پروتئین فلورسنت قرمزProteinase K - پروتئیناز KPten - ژن PTENvoltage-dependent anion channel - کانال آنیون وابسته به ولتاژCalcium - کلسیمReactive oxygen species - گونههای فعال اکسیژنInositol 1,4,5-trisphosphate receptor - گیرنده inositol 1،4،5-trisphosphate
موضوعات مرتبط
علوم زیستی و بیوفناوری
بیوشیمی، ژنتیک و زیست شناسی مولکولی
زیست شیمی
پیش نمایش صفحه اول مقاله

چکیده انگلیسی
The tumor suppressor PTEN is a key regulator of a plethora of cellular processes that are crucial in cancer development. Through its lipid phosphatase activity PTEN suppresses the PI3K/AKT pathway to govern cell proliferation, growth, migration, energy metabolism and death. The repertoire of roles fulfilled by PTEN has recently been expanded to include crucial functions in the nucleus, where it favors genomic stability and restrains cell cycle progression, as well as protein phosphatase dependent activity at the endoplasmic reticulum (ER) and mitochondria-associated membranes (MAMs), where PTEN interacts with the inositol 1,4,5-trisphosphate receptors (IP3Rs) and regulates Ca2+ release from the ER and sensitivity to apoptosis. Indeed, PTEN is present in definite subcellular locations where it performs distinct functions acting on specific effectors. In this review, we summarize recent advantages in methods to study PTEN subcellular localization and the distinct biological functions of PTEN in different cellular compartments. A deeper understanding of PTEN's compartmentalized-functions will guide the rational design of novel therapies.
ناشر
Database: Elsevier - ScienceDirect (ساینس دایرکت)
Journal: Methods - Volumes 77â78, 1 May 2015, Pages 92-103
Journal: Methods - Volumes 77â78, 1 May 2015, Pages 92-103
نویسندگان
Angela Bononi, Paolo Pinton,